BMP7

BMP7
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1BMP, 1LX5, 1LXI, 1M4U

Ідентифікатори
Символи BMP7, OP-1, bone morphogenetic protein 7
Зовнішні ІД OMIM: 112267 MGI: 103302 HomoloGene: 20410 GeneCards: BMP7
Онтологія гена
Молекулярна функція

heparin binding
cytokine activity
transforming growth factor beta receptor binding
growth factor activity
BMP receptor binding
GO:0001948, GO:0016582 protein binding

Клітинна компонента

extracellular region
GO:0005578 Позаклітинна матриця
міжклітинний простір
везикула
collagen-containing extracellular matrix

Біологічний процес

розвиток ока
pattern specification process
skeletal system development
ureteric bud development
negative regulation of neuron differentiation
embryonic pattern specification
mesenchyme development
anatomical structure formation involved in morphogenesis
negative regulation of cell cycle
mesonephros development
odontogenesis of dentin-containing tooth
mesenchymal cell differentiation
negative regulation of mitotic nuclear division
animal organ morphogenesis
metanephric mesenchyme morphogenesis
metanephros development
cellular response to hypoxia
regulation of pathway-restricted SMAD protein phosphorylation
regulation of removal of superoxide radicals
steroid hormone mediated signaling pathway
negative regulation of Notch signaling pathway
negative regulation of cell population proliferation
branching involved in salivary gland morphogenesis
regulation of apoptotic process
SMAD protein signal transduction
осифікація
розвиток нирки
negative regulation of cell death
tube morphogenesis
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
negative regulation of prostatic bud formation
cartilage development
embryonic limb morphogenesis
negative regulation of MAP kinase activity
embryonic camera-type eye morphogenesis
positive regulation of neuron differentiation
positive regulation of cell differentiation
negative regulation of phosphorylation
regulation of branching involved in prostate gland morphogenesis
диференціація клітин
neuron projection morphogenesis
nephrogenic mesenchyme morphogenesis
positive regulation of heterotypic cell-cell adhesion
epithelial cell differentiation
response to vitamin D
positive regulation of hyaluranon cable assembly
positive regulation of bone mineralization
dendrite development
negative regulation of neurogenesis
regulation of phosphorylation
BMP signaling pathway
positive regulation of osteoblast differentiation
Епітеліально-мезенхімальний перехід
GO:0045996 negative regulation of transcription, DNA-templated
negative regulation of NF-kappaB transcription factor activity
branching morphogenesis of an epithelial tube
negative regulation of mesenchymal cell apoptotic process involved in nephron morphogenesis
negative regulation of glomerular mesangial cell proliferation
response to estradiol
monocyte aggregation
metanephric mesenchymal cell proliferation involved in metanephros development
positive regulation of cell death
розвиток клітин
negative regulation of striated muscle cell apoptotic process
positive regulation of pathway-restricted SMAD protein phosphorylation
mesoderm formation
response to peptide hormone
cellular response to BMP stimulus
positive regulation of dendrite development
salivary gland morphogenesis
axon guidance
multicellular organism development
positive regulation of peptidyl-threonine phosphorylation
positive regulation of apoptotic process
protein localization to nucleus
embryonic skeletal joint morphogenesis
camera-type eye morphogenesis
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
endocardial cushion formation
pericardium morphogenesis
neural fold elevation formation
hindbrain development
cardiac muscle tissue development
pharyngeal system development
cardiac septum morphogenesis
chorio-allantoic fusion
heart trabecula morphogenesis
allantois development
positive regulation of epithelial to mesenchymal transition
positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis
regulation of signaling receptor activity
GO:1901313 positive regulation of gene expression
negative regulation of NIK/NF-kappaB signaling
regulation of MAPK cascade

Джерела:Amigo / QuickGO
Ортологи
Види Людина Миша
Entrez
655
12162
Ensembl
ENSG00000101144
ENSMUSG00000008999
UniProt
P18075
P23359
RefSeq (мРНК)
NM_001719
NM_007557
RefSeq (білок)
NP_001710
NP_001710.1
NP_031583
Локус (UCSC) Хр. 20: 57.17 – 57.27 Mb Хр. 2: 172.71 – 172.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BMP7 (англ. Bone morphogenetic protein 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 431 амінокислот, а молекулярна маса — 49 313[4].

Послідовність амінокислот
1020304050
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQE
RREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGG
QGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPR
YHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQE
HLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVE
TLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIA
PEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQ
LNAISVLYFDDSSNVILKKYRNMVVRACGCH

Кодований геном білок за функціями належить до цитокінів, факторів росту, білків розвитку. Задіяний у таких біологічних процесах, як остеогенез, диференціація клітин. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Wyatt A.W., Osborne R.J., Stewart H., Ragge N.K. (2010). Bone morphogenetic protein 7 (BMP7) mutations are associated with variable ocular, brain, ear, palate, and skeletal anomalies. Hum. Mutat. 31: 781—787. PMID 20506283 DOI:10.1002/humu.21280
  • Griffith D.L., Keck P.C., Sampath T.K., Rueger D.C., Carlson W.D. (1996). Three-dimensional structure of recombinant human osteogenic protein 1: structural paradigm for the transforming growth factor beta superfamily. Proc. Natl. Acad. Sci. U.S.A. 93: 878—883. PMID 8570652 DOI:10.1073/pnas.93.2.878

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1074 (англ.) . Процитовано 12 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P18075 (англ.) . Архів оригіналу за 3 березня 2018. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 20
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»