FADD

FADD
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

3OQ9, 1A1W, 1A1Z, 1E3Y, 1E41, 2GF5, 3EZQ

Ідентифікатори
Символи FADD, GIG3, MORT1, Fas associated via death domain, IMD90
Зовнішні ІД OMIM: 602457 MGI: 109324 HomoloGene: 2836 GeneCards: FADD
Онтологія гена
Молекулярна функція

identical protein binding
tumor necrosis factor receptor superfamily binding
death effector domain binding
caspase binding
GO:0001948, GO:0016582 protein binding
protease binding
death receptor binding
tumor necrosis factor receptor binding
receptor serine/threonine kinase binding
GO:0032403 protein-containing complex binding

Клітинна компонента

гіалоплазма
membrane raft
ripoptosome
cell body
neuron projection
CD95 death-inducing signaling complex
клітинна мембрана
death-inducing signaling complex
цитоплазма
клітинне ядро
GO:0009327 protein-containing complex

Біологічний процес

TRAIL-activated apoptotic signaling pathway
regulation of extrinsic apoptotic signaling pathway via death domain receptors
motor neuron apoptotic process
процес імунної системи
necroptotic signaling pathway
activation of cysteine-type endopeptidase activity involved in apoptotic process
negative regulation of necroptotic process
positive regulation of interleukin-8 production
positive regulation of type I interferon-mediated signaling pathway
cell surface receptor signaling pathway
TRIF-dependent toll-like receptor signaling pathway
positive regulation of macrophage differentiation
defense response to virus
activation of cysteine-type endopeptidase activity
apoptotic signaling pathway
cellular response to mechanical stimulus
extrinsic apoptotic signaling pathway in absence of ligand
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
extrinsic apoptotic signaling pathway via death domain receptors
regulation of apoptotic process
death-inducing signaling complex assembly
positive regulation of extrinsic apoptotic signaling pathway via death domain receptors
positive regulation of tumor necrosis factor production
positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0072468 сигнальна трансдукція
positive regulation of proteolysis
GO:0022415 viral process
GO:0097285 апоптоз
positive regulation of activated T cell proliferation
extrinsic apoptotic signaling pathway
positive regulation of T cell mediated cytotoxicity
positive regulation of extrinsic apoptotic signaling pathway
thymus development
positive regulation of adaptive immune response
T cell differentiation in thymus
вроджений імунітет
spleen development
negative regulation of activation-induced cell death of T cells
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
positive regulation of interferon-gamma production
positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation
lymph node development
T cell homeostasis
response to cocaine
response to morphine
behavioral response to cocaine
regulation of necroptotic process
positive regulation of apoptotic process
toll-like receptor 3 signaling pathway
розвиток нирки

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
8772
14082
Ensembl
ENSG00000168040
ENSMUSG00000031077
UniProt
Q13158
Q61160
RefSeq (мРНК)
NM_003824
NM_010175
RefSeq (білок)
NP_003815
NP_034305
Локус (UCSC) Хр. 11: 70.2 – 70.21 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FADD (англ. Fas associated via death domain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 208 амінокислот, а молекулярна маса — 23 279[4].

Послідовність амінокислот
1020304050
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLL
EQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAA
FNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN
TEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNS
DASTSEAS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, імунітет, вроджений імунітет, взаємодія хазяїн-вірус.

Література

  • Chinnaiyan A.M., O'Rourke K., Tewari M., Dixit V.M. (1995). FADD, a novel death domain-containing protein, interacts with the death domain of Fas and initiates apoptosis. Cell. 81: 505—512. PMID 7538907 DOI:10.1016/0092-8674(95)90071-3
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Telliez J.-B., Bean K.M., Lin L.-L. (2000). LRDD, a novel leucine rich repeat and death domain containing protein. Biochim. Biophys. Acta. 1478: 280—288. PMID 10825539 DOI:10.1016/S0167-4838(00)00029-7

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:3573 (англ.) . Архів оригіналу за 25 березня 2016. Процитовано 8 вересня 2017.
  4. UniProt, Q13158 (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 8 вересня 2017.

Див. також

  • Хромосома 11

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.


Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.