RIPK2

RIPK2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

4C8B, 2N7Z, 5AR3, 5AR2, 5AR7, 5AR8, 5AR5, 5AR4, 2N83, 5J7B, 5J79

Ідентифікатори
Символи RIPK2, CARD3, CARDIAK, CCK, GIG30, RICK, RIP2, receptor interacting serine/threonine kinase 2
Зовнішні ІД OMIM: 603455 MGI: 1891456 HomoloGene: 37856 GeneCards: RIPK2
шифр КФ 2.7.10.2
Пов'язані генетичні захворювання
проказа[1]
Онтологія гена
Молекулярна функція

• LIM domain binding
• kinase activity
• CARD domain binding
• signaling receptor binding
• ATP binding
• protein kinase activity
• non-membrane spanning protein tyrosine kinase activity
• transferase activity
• protein homodimerization activity
• GO:0001948, GO:0016582 protein binding
• nucleotide binding
• signal transducer activity
• protein serine/threonine kinase activity
• identical protein binding
• caspase binding
• JUN kinase kinase kinase activity

Клітинна компонента

• цитоплазма
• цитоскелет
• везикула
• гіалоплазма
• GO:0009327 protein-containing complex

Біологічний процес

• response to interleukin-1
• positive regulation of cytokine-mediated signaling pathway
• response to exogenous dsRNA
• positive regulation of JNK cascade
• positive regulation of xenophagy
• cellular response to muramyl dipeptide
• protein phosphorylation
• positive regulation of ERK1 and ERK2 cascade
• cellular response to peptidoglycan
• positive regulation of stress-activated MAPK cascade
• GO:0051637 defense response to Gram-positive bacterium
• GO:0097285 апоптоз
• regulation of apoptotic process
• positive regulation of immature T cell proliferation
• positive regulation of interleukin-12 production
• positive regulation of interferon-alpha production
• positive regulation of peptidyl-serine phosphorylation
• JNK cascade
• response to interleukin-12
• nucleotide-binding oligomerization domain containing 2 signaling pathway
• positive regulation of T-helper 1 type immune response
• positive regulation of alpha-beta T cell proliferation
• positive regulation of interleukin-6 production
• positive regulation of tumor necrosis factor production
• positive regulation of peptidyl-tyrosine phosphorylation
• inflammatory response
• I-kappaB kinase/NF-kappaB signaling
• nucleotide-binding oligomerization domain containing 1 signaling pathway
• positive regulation of interferon-beta production
• фосфорилювання
• процес імунної системи
• positive regulation of T-helper 1 cell differentiation
• negative regulation of apoptotic process
• cellular response to lipoteichoic acid
• positive regulation of interleukin-2 production
• positive regulation of chemokine production
• nucleotide-binding oligomerization domain containing signaling pathway
• positive regulation of protein ubiquitination
• lipopolysaccharide-mediated signaling pathway
• positive regulation of interferon-gamma production
• T cell proliferation
• positive regulation of peptidyl-threonine phosphorylation
• positive regulation of apoptotic process
• positive regulation of I-kappaB kinase/NF-kappaB signaling
• peptidyl-tyrosine phosphorylation
• cellular response to lipopolysaccharide
• T cell receptor signaling pathway
• response to interleukin-18
• GO:0072468 сигнальна трансдукція
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• toll-like receptor 4 signaling pathway
• toll-like receptor 2 signaling pathway
• вроджений імунітет
• MAPK cascade
• адаптивна імунна відповідь
• positive regulation of protein binding
• positive regulation of NF-kappaB transcription factor activity
• activation of cysteine-type endopeptidase activity
• positive regulation of cell death
• interleukin-1-mediated signaling pathway

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
8767
192656
Ensembl
ENSG00000104312
ENSMUSG00000041135
UniProt
O43353
P58801
RefSeq (мРНК)
NM_003821
NM_001375360
NM_138952
NM_001329751
RefSeq (білок)
NP_003812
NP_001362289
NP_001316680
NP_620402
Локус (UCSC) Хр. 8: 89.76 – 89.79 Mb Хр. 4: 16.12 – 16.16 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RIPK2 (англ. Receptor interacting serine/threonine kinase 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 540 амінокислот, а молекулярна маса — 61 195[5].

Послідовність амінокислот
1020304050
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLH
IHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPN
GSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQ
NILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEP
GQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVI
NEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQ
LHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISG
SQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQ
MTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEE
FAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, адаптивний імунітет, імунітет, вроджений імунітет, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі.

Література

  • Inohara N., del Peso L., Koseki T., Chen S., Nunez G. (1998). RICK, a novel protein kinase containing a caspase recruitment domain, interacts with CLARP and regulates CD95-mediated apoptosis. J. Biol. Chem. 273: 12296—12300. PMID 9575181 DOI:10.1074/jbc.273.20.12296
  • McCarthy J.V., Ni J., Dixit V.M. (1998). RIP2 is a novel NF-kappaB-activating and cell death-inducing kinase. J. Biol. Chem. 273: 16968—16975. PMID 9642260 DOI:10.1074/jbc.273.27.16968
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Ruefli-Brasse A.A., Lee W.P., Hurst S., Dixit V.M. (2004). Rip2 participates in Bcl10 signaling and T-cell receptor-mediated NF-kappaB activation. J. Biol. Chem. 279: 1570—1574. PMID 14638696 DOI:10.1074/jbc.C300460200
  • Manon F., Favier A., Nunez G., Simorre J.P., Cusack S. (2007). Solution structure of NOD1 CARD and mutational analysis of its interaction with the CARD of downstream kinase RICK. J. Mol. Biol. 365: 160—174. PMID 17054981 DOI:10.1016/j.jmb.2006.09.067
  • Clark N.M., Marinis J.M., Cobb B.A., Abbott D.W. (2008). MEKK4 sequesters RIP2 to dictate NOD2 signal specificity. Curr. Biol. 18: 1402—1408. PMID 18775659 DOI:10.1016/j.cub.2008.07.084

Примітки

  1. ↑ Захворювання, генетично пов'язані з RIPK2 переглянути/редагувати посилання на ВікіДаних.
  2. ↑ Human PubMed Reference:.
  3. ↑ Mouse PubMed Reference:.
  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:10020 (англ.) . Процитовано 7 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. ↑ UniProt, O43353 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 7 вересня 2017.

Див. також

  • Хромосома 8
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.